LIF, a member of Interleukin 6 family, is a pleiotropic factor produced by multiple cell types, including T cells, myelomonocytic lineages, fibroblasts, liver, heart and melanoma. LIF promotes long-term maintenance of embryonic stem cells by suppressing spontaneous differentiation. Other activities include the stimulation of acute phase protein synthesis by hepatocytes, stimulation of differentiation of cholinergic nerves, and suppression of adipogenesis by inhibiting the lipoprotein lipase in adipocytes. While human LIF is active on mouse cells and is widely used in the maintenance of murine ESC to prevent spontaneous differentiation, mouse LIF is not active on human cells due to its inability to bind to the human LIF receptor. Mature human LIF (180a.a.) shares 78 %, 82%, 91%, 88% and 87%a.a. sequence identity with mouse, rat, canine, bovine, and porcine LIF, respectively. Recombinant Human LIF is a 19.7kDa protein containing 180 amino acid residues, including three disulfide bonds.
u Product Information
|
Product Name
|
Recombinant Human Leukemia Inhibitory Factor
(rHuLIF)
|
|
Source
|
Expressed in E. coli.
|
|
Molecular weight
|
Approximately 19.7kDa, a single non-glycosylated polypeptide chain containing 180 amino acids.
|
|
Accession
|
P15018 Ser23-Phe202
|
|
AA Sequence
|
SPLPITPVNATCAIRHPCHNNLMNQIRSQLAQLNGSANALFILYYTAQGEPFPNNLDKLCGPNVTDFPPFHANGTEKAKLVELYRIVVYLGTSLGNITRDQKILNPSALSLHSKLNATADILRGLLSNVLCRLCSKYHVGHVDVTYGPDTSGKDVFQKKKLGCQLLGKYKQIIAVLAQAF
|
|
Purity
|
＞98% by SDS-PAGE or HPLC
|
|
Formulation
|
Lyophilized from a 0.2mm filtered solution in PBS, pH 7.2.
|
|
Biological activity
|
Fully biologically active when compared to standard. The ED50 as determined by the dose-dependent proliferation of human TF-1 cells is less than 0.1 ng/ml, corresponding to a specific activity of > 1.0 × 107 IU/mg.
|
|
Endotoxin level
|
Less than 0.1EU/mg of rHuLIF as determined by LAL method
|
|
Reconstitution
|
Before use this product, please read the direction below carefully.
1、 This vial must be briefly centrifuged prior to opening to bring the contents to the bottom.
2、 Reconstitute in sterile distilled water or aqueous buffer containing 0.1% BSA to a concentration of 0.1-1.0mg/ml.
Stock solutions should be apportioned into working aliquots and stored at ≤-20℃. Further dilutions should be made in appropriate buffered solutions.
|
|
Storage/ Stability
|
For long term storage, the product should be stored≤-20℃.
36 months, -20 to -70℃ as supplied.
1 month, 2 to 8℃ under sterile conditions after reconstitution;
3 months, -20 to -70℃ under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.
|
|
THIS PRODUCT IS FOR RESEARCH, LABORATORY AND EVALUATION PURPOSE ONLY.
|
