Macrophage migration inhibitory factor (MIF or MMIF), also named as glycosylation-inhibiting factor (GIF), L-dopachrome isomerase, or phenylpyruvate tautomerase, is a protein encoded by the MIF gene. It is released from white blood cells by bacterial antigen stimulation to trigger an acute immune response, or by glucocorticoids to counter-act the inhibitory effects of glucocorticoids on immune system. MIF is a homotrimer of which each subunit contains 115 amino acids. As mentioned above, MIF is involved in the innate immune response to bacterial pathogens and counter-acts the anti-inflammatory activity of glucocorticoids. Furthermore, it also plays a role as mediator in regulating the function of macrophages in host defense and has phenylpyruvate tautomerase and dopachrome tautomerase activity in vitro. MIF induces, IL-1, IL-8 and MMP expression; on macrophages, MIF stimulates NO production and TNF-α release following IFN-γ activation. MIF apparently acts through CD74 and CD44, likely in some form of trimeric interaction. Human MIF is active on mouse cells. Human MIF is 90%, 94%, 95%, and 90% sequences identical to mouse, bovine, porcine and rat MIF, respectively. Recombinant human MIF is a 12.5kDa protein consisting of 115 amino acid residues.
u Product Information
|
Product Name
|
Recombinant human migration inhibitor factor
(rHuMIF)
|
|
Synonyms
|
MIF, DER6, GIF, L-dopachrome Isomerase, L-dopachrome Tautomerase, Phenylpyruvate Tautomerase
|
|
Source
|
Expressed in E. coli.
|
|
Molecular weight
|
Approximately 12.5kDa, a single non-glycosylated polypeptide chain containing 115 amino acids.
|
|
Accession
|
P14174 Met1- Ala115
|
|
AA Sequence
|
MPMFIVNTNVPRASVPDGFLSELTQQLAQATGKPPQYIAVHVVPDQLMAFGGSSEPCALCSLHSIGKIGGAQNRSYSKLLCGLLAERLRISPDRVYINYYDMNAANVGWNNSTFA
|
|
Purity
|
＞98% by SDS-PAGE or HPLC.
|
|
Biological activity
|
Fully biologically active when compared to standard. The specific activity is determined by binding rhCD74 in a functional ELISA.
|
|
Formulation
|
Lyophilized from a 0.2µm filtered concentrated solution in 20mM PB, 150mM NaCl pH 7.4, with 5% trehalose, 0.02% Tween-80.
|
|
Endotoxin level
|
＜0.1EU/μg rHuMIF protein as determined by LAL method.
|
|
Reconstitution
|
Before use this product, please read the direction below carefully.
1、 This vial must be briefly centrifuged prior to opening to bring the contents to the bottom.
2、 Reconstitute in sterile distilled water or aqueous buffer containing 0.1%BSA to a concentration of 0.1-1.0mg/ml.
Stock solutions should be apportioned into working aliquots and stored at ≤-20℃. Further dilutions should be made in appropriate buffered solutions.
|
|
Storage/ Stability
|
White lyophilized powder. For long term storage, the product should be stored ≤-20℃.
36 months, -20 to -70℃ as supplied.
1 month, 2 to 8℃ under sterile conditions after reconstitution;
3 months, -20 to -70℃ under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.
|
|
THIS PRODUCT IS FOR RESEARCH, LABORATORY AND EVALUATION PURPOSE ONLY.
|
